Canada-only shipping · Free over $299 · Interac e-Transfer
BlueNexLabs Inc.Peptides for laboratory research

Research · 2026-09-24

Scientific lead: Alice Kay, Ph.D.

LL-37 cathelicidin laboratory note

LL-37 Research Overview

LL-37 is recorded here as the 37-residue C-terminal peptide of human cathelicidin hCAP18. The 5 mg vial is a separate catalog URL.

This page provides laboratory-focused information for LL-37. Content is intended for research use only and should be read with the published documentation and analytical data.

Diagram for the LL-37 cathelicidin laboratory note

Research-use notice: This article is laboratory and educational information only. It is not medical or legal advice, and it does not include how-to-use instructions. BlueNex Labs materials are research-use only and are not intended for human or veterinary use. Research-use-only labeling is not a Health Canada authorization.

Publication status: Prepared for the BlueNex Labs Research Knowledge Centre. Literature and library notes checked September 24, 2026. Primary papers and the public COA library can change; verify the lot report in hand before an assay.

LL-37, on this catalog, is a lyophilized 37-residue peptide sold for laboratory work. The shop URL is LL-37 5mg. This page is the sequence note. It is not a method, and it does not restate infection-model outcomes from the literature. Price and stock stay on the listing.

Sequence

A 2025 review of cathelicidin peptides in Pharmaceuticals states the mature human peptide as the 37-residue chain [LL-37, 37 aa], cleaved from the C terminus of the hCAP18 precursor encoded by CAMP (PMC12386566). The chain begins with two leucines, which is the naming convention the review records. Thirty-seven residues, a linear string, and no disulfide in that written sequence are the identity marks this note uses. The glossary lines are sequence, linear peptide, and C-terminus.

Count to thirty-seven before you accept a shorter fragment as the same vial. The review's written string has no cysteine pair, so this note does not describe a disulfide bridge for the sequence as printed. If a lot report names a different species or a truncated chain, it is a different identity. The NCBI gene record for CAMP describes a precursor with a conserved cathelin-like region and a variable C-terminal peptide released by proteolysis. This note does not invent a second sequence. If the report's mass does not match the 37-residue chain under the species the laboratory named, stop and hold the vial.

What membrane papers are for

The review discusses membrane interaction and amphipathic helix language for this peptide family. Those are structural descriptions in the paper. They are not a method for the 5 mg vial, and this catalog does not restate them as a property a purchaser can expect from a cake. Copy the sequence and the length. Leave the biophysical claims in the paper that measured them.

KPV, a short melanocortin fragment, has its own listing and its own note at the KPV research note. Thymosin alpha-1 is a different peptide with its own note. BPC-157 is a pentadecapeptide with its own note. None of those certificates document LL-37. A host-defense label in a paper is a literature class. It is not a second name for KPV and it is not a consumer phrase on this catalog.

Analytical documentation

A catalog name is not an identity test for LL-37 5mg. Open how to read a peptide Certificate of Analysis and the purity-versus-mass note. The short version of the same check is the COA verification FAQ. Copy the task identifier from the Janoshik URL on verify.janoshik.com or janoshik.com, the sample name, the date, the mass, the purity figure and its method, and any endotoxin number with its unit. A photograph of a report is not the report. Cap colour and the labeled milligram size are lot-specific. A file for a different size does not document this container.

Chromatographic area percent and mass identity answer different questions. Read chromatogram, mass spectrum, purity versus identity, and molecular weight before you file one number as both answers. Salt form, when the PDF names trifluoroacetate or acetate, is a third line. The glossary entries are TFA salt and acetate salt. This catalog does not publish a house factor that converts a salt weight into a free-base figure. If the report is silent, leave the salt line blank. Net peptide content is recorded only when the PDF states it.

The library row for a published LL-37 lot is LL-37 5mg in the certificates library. Match the sample name and the 5 mg size. A 10 mg file for a different peptide does not become an LL-37 file because both arrived in the same parcel.

The receiving log for this material is ordinary and short. Write the product name, the labeled amount, the cap colour if one is printed, the lot number or batch code, the receipt date, the storage location, the report URL, and whether the sample name matched the container in hand. Quarantine the container when the seal is broken, the solid looks wet, the label does not match the packing list, or the report link will not open. The Burnaby desk can look up an order number. It cannot reconstruct identity from a container that has already been relabeled by hand.

Handling and Canada fulfilment

The solid is stored sealed because residual water can cleave peptide bonds and can collapse a cake. The format primer is lyophilized research peptides. Open the parcel the day it arrives. Do not leave it in a vehicle, an outdoor box, or on a loading dock. Move the closed vial into controlled storage and follow the temperature on the product note. A cake that looks different after a cold Canada Post parcel is not an identity test. Do not heat a very cold vial. The receiving note is peptide storage for Canadian laboratories. This page does not list a diluent volume. If a laboratory SOP calls for a separate diluent, bacteriostatic water and reconstitution diluent are glossary entries for that reagent, not a volume for this vial.

Paid orders ship on Canada Post Xpresspost inside Canada after Interac e-Transfer. The public desk is 4309 Canada Way, Burnaby, BC. The label sender is a Port Moody, B.C. PO Box for the carrier account. Put the order number in the Interac message field so the payment can be matched to the emailed invoice. Tracking is emailed after a scan, typically within one business day of payment. Canada Post does not operate on weekends or statutory holidays, so a Friday payment can sit until the next operating day. Estimates are not guarantees. Those facts are restated on the shipping FAQ and the payment FAQ. The procurement note is Canada laboratory procurement. The shop URL is LL-37 5mg.

A research-use-only container is not a clinical-trial drug product and it does not carry a Drug Identification Number. The distinction is on the catalog-versus-trial FAQ. What the research-use-only phrase does and does not do, including the point that the phrase is not by itself a Health Canada authorization, is on the research-use-only FAQ. This page is not legal advice. Domestic Xpresspost keeps the parcel on a Canadian carrier. It does not remove research-use-only limits, and it does not make a catalog solid into an authorized drug.

The cellular category also lists thymosin alpha-1, KPV, and other signaling peptides. Each keeps its own sample name. The disulfide bridge glossary line is linked so a receiver can see what this written sequence does not claim.

The category index that currently lists this material is the cellular category. Host-defense is the literature class used by the review. The category grid is a purchasing route. It does not merge LL-37 with KPV.

Frequently asked questions

How many residues are in the LL-37 sequence cited here?

Thirty-seven. The cathelicidin review cited on this page writes the chain as [LL-37, 37 aa] Confirm the mass on the lot report rather than trusting the page alone.

Is LL-37 the same sequence as KPV?

No. KPV is a short melanocortin fragment with its own vial and its own note. LL-37 is the longer cathelicidin C-terminal peptide. Do not file one certificate as the other.

Does this LL-37 note list a membrane method?

No. It names the structural class used in membrane-interaction papers and points at the lot file. It does not give a method.

Where is the LL-37 5 mg listing?

The shop URL is /shop/ll37-5mg. The certificates library is separate. Match the sample name to the vial in hand.

Research-use only. BlueNex Labs does not provide medical or veterinary advice. Confirm your institution’s policies before purchase.